The Journal of Biochemistry
Online ISSN : 1756-2651
Print ISSN : 0021-924X
Pseudomonas stutzeri Ferredoxin: Close Similarity to Azotobacter vinelandii and Pseudomonas ovalis Ferredoxins
Kazuhiko SaekiSadao WakabayashiWalter G. ZumftHiroshi Matsubara
Author information
JOURNAL FREE ACCESS

1988 Volume 104 Issue 2 Pages 242-246

Details
Abstract

The complete primary structure of Pseudomonas stutzeri strain ZoBell ferredoxin was determined by a combination of protease digestion, Edman degradation, and carboxypep- tidase digestion and was: TFV VTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDQQEFIELNADLAEVWPNITE K K D A L A D A E E W D G V K D K L Q Y L E R. The calculated molecular weight was 12, 110 excluding iron and sulfur atoms. The amino acid sequence was highly homologous to those of Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. It showed, like the other two, a Tyr-Thr insertion between the second and third Cys, and extra Cys at position 24 and, compared to Clostridium- and Bacillus-type ferredoxins, an extended C-terminal sequence.

Content from these authors
© The Japanese Biochemical Society
Previous article Next article
feedback
Top